PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC11918_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family TALE
Protein Properties Length: 421aa    MW: 47791.9 Da    PI: 6.9159
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC11918_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox31.13.9e-102833201954
                  HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
     Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                  Fe   ++yp+++e+  LAk++gL+++qV +WF N R +
  RrC11918_p1 283 FEHflHPYPKESEKIMLAKQTGLSKNQVANWFINARVR 320
                  664459******************************88 PP

2BELL115.62.4e-37146217172
         BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                  erqelq+kk+kLl++++eVd +Y+qy++q+++++ssFe+vaglg+akpYt++Al++iSrhFrcL+da++eq+
  RrC11918_p1 146 ERQELQSKKNKLLTMVNEVDLKYNQYHHQMEALASSFEMVAGLGAAKPYTTVALNRISRHFRCLRDALKEQV 217
                  79********************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005747.3E-4491215IPR006563POX domain
PfamPF075263.2E-4197213IPR006563POX domain
PROSITE profilePS5007112.536261324IPR001356Homeobox domain
CDDcd000861.89E-11264325No hitNo description
SMARTSM003895.4E-10264328IPR001356Homeobox domain
SuperFamilySSF466897.7E-18265332IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-28267330IPR009057Homeodomain-like
PfamPF059204.9E-18281320IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 421 aa     Download sequence    Send to blast
MVFIPPTSDE AVVTGLNGSS GGGLSLSLGN HQIQYHYQNL SNQLSYPSLS NENEKSLHHH  60
HQQQPEHVPS SGYINGVGSG LYNNHRYETT GGFVSSVLRS PYLKPTQQLL DEVVSVRKLG  120
GDSNKKIKNN TNVSSENNNE ELSSSERQEL QSKKNKLLTM VNEVDLKYNQ YHHQMEALAS  180
SFEMVAGLGA AKPYTTVALN RISRHFRCLR DALKEQVGVM RGKLGEEESK EEEGERIPRL  240
RYLDQRLRQQ RALHQQLGMV RPSWRPQRGL PENSVSVLRA WLFEHFLHPY PKESEKIMLA  300
KQTGLSKNQV ANWFINARVR LWKPMIEEMY KEEFGDSSEL LSNSNQDSNI KMQETSQLKH  360
EDSSSSQQQS HGNNNVTDTS DADRGDYDSL MNYHQGFGAD DYNRYIGGLG DQQDGRFSNP  420
H
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_B5e-16270327158Homeobox protein Meis1
4xrs_A5e-16270327158Homeobox protein Meis1
4xrm_B5e-16270328563Homeobox protein Meis2
4xrm_A5e-16270328563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006390306.10.0hypothetical protein EUTSA_v10018381mg
RefseqXP_006390307.10.0hypothetical protein EUTSA_v10018381mg
SwissprotQ9FWS90.0BLH3_ARATH; BEL1-like homeodomain protein 3
TrEMBLV4KK100.0V4KK10_EUTSA; Uncharacterized protein
STRINGBra003753.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38201959
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75410.21e-158BEL1-like homeodomain 3